4 products were found matching "GeneID 58530"!

No results were found for the filter!
LY6G6D, Human lymphocyte antigen 6 complex, locus G6D, Real Time PCR Primer Set
LY6G6D, Human lymphocyte antigen 6 complex, locus G6D,...

Item number: VHPS-5429

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1...
Application: RNA quantification
43.00€ *
Review
Lymphocyte Antigen 6 Complex Locus Protein G6d, Recombinant, Human, aa10-104, His-B2M-JD-tag (LY6G6D
Lymphocyte Antigen 6 Complex Locus Protein G6d,...

Item number: 405978.100

Source:, Recombinant protein corresponding to aa10-104 from human lymphocyte Antigen 6 complex locus protein G6d, fused to His-B2M-JD-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.5kD, AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS,...
Keywords: LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1...
MW: 15,5
From 511.00€ *
Review
Lymphocyte Antigen 6 Complex Locus Protein G6d, Recombinant, Human, aa20-104, His-B2M-Tag (LY6G6D)
Lymphocyte Antigen 6 Complex Locus Protein G6d,...

Item number: 517986.100

Source:, Recombinant protein corresponding to aa20-104 of human Lymphocyte Antigen 6 Complex Locus Protein G6d, fused to 10xHis-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.5kD, AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS, Storage and...
Keywords: LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1...
Expressed in: E.coli
Origin: human
MW: 25.5 kD
From 511.00€ *
Review
LY6G6D, Recombinant, Human, aa20-104, His-Tag (Lymphocyte Antigen 6 Complex Locus Protein G6d)
LY6G6D, Recombinant, Human, aa20-104, His-Tag (Lymphocyte...

Item number: 374098.100

Source:, Recombinant protein corresponding to aa20-104 from human LY6G6D, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12kD, AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS, Storage and Stability: May be stored at 4°C for short-term only....
Keywords: LY6G6D, C6orf23, Protein Ly6-D, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1...
MW: 12
From 531.00€ *
Review